PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C019621P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family G2-like
Protein Properties Length: 316aa    MW: 34762.6 Da    PI: 8.7086
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C019621P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like50.35.4e-1611402655
         G2-like 26 kAtPktilelmkvkgLtlehvkSHLQkYRl 55
                    +AtPkti+++m+vkgLtl+h+kSHLQk+Rl
  MELO3C019621P1 11 EATPKTIMRVMGVKGLTLYHLKSHLQKFRL 40
                    7****************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466894.3E-6341IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.7E-14841IPR009057Homeodomain-like
TIGRFAMsTIGR015574.7E-10941IPR006447Myb domain, plants
PfamPF143794.0E-2182121IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 316 aa     Download sequence    Send to blast
MIFLSHISLA EATPKTIMRV MGVKGLTLYH LKSHLQKFRL GKQPHKEFND QSIKDGIRAS  60
ALELQRNSGS SSTLMDRSMN EMHMEVQRRL HEQIEVQRHL QLRIEAQGKY MQSILEKACQ  120
TLAGENMAAA TAGPFKTTSN NMGTTTSLVS DAAIKDFISP HHTFPPFQDM NNLFNSEPPP  180
PPPPLIDCLK KPSPFISGAG KTPIFWPDDL RLQDLGTPSA TLAPAPPPIG GAPDLDSLQL  240
EMYESKPPPP TPLLAVGNNV MNEKKFDMTL KLERPSPPRS GHSDERLNSN NNNNGMANNN  300
NPTMLQPQGR NSSFG*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6819210.0LN681921.1 Cucumis melo genomic scaffold, anchoredscaffold00039.
GenBankLN7132650.0LN713265.1 Cucumis melo genomic chromosome, chr_11.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008456284.10.0PREDICTED: myb family transcription factor APL-like
SwissprotQ9SAK53e-68APL_ARATH; Myb family transcription factor APL
TrEMBLA0A0A0KAM11e-165A0A0A0KAM1_CUCSA; Uncharacterized protein
STRINGGLYMA15G29620.13e-91(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G79430.27e-68G2-like family protein